PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRIUR3_18966-P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 110aa    MW: 12360.9 Da    PI: 10.7101
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRIUR3_18966-P1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.38.6e-0941781047
                     HHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding 10 ellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +l++ + k +G+g+W+ I+r +  +Rt+ q+ s+ qky
  TRIUR3_18966-P1 41 QLFLLGLKTYGKGDWRNISRNFVRTRTPTQVASHAQKY 78
                     789999*******************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00263181IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-64177IPR009057Homeodomain-like
CDDcd001675.53E-74179No hitNo description
PfamPF002491.7E-64178IPR001005SANT/Myb domain
SuperFamilySSF466899.36E-114183IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-104181IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MKRNSRVFGS GQSKNEGDTV DMIFGDLRTW ATAGIDEMAM QLFLLGLKTY GKGDWRNISR  60
NFVRTRTPTQ VASHAQKYFI RLSSGTARRS SIHDITTVHL TDDQPPSPSQ
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU8570361e-104KU857036.1 Triticum aestivum GID2 protein isoform 1 (gid2) mRNA, complete cds.
GenBankKU8570391e-104KU857039.1 Triticum urartu GID2 protein (gid2) mRNA, complete cds.
GenBankKU8570451e-104KU857045.1 Triticum aestivum GID2-A1 protein (gid2-A1) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568449.11e-36PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H78e-32DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM8ATW55e-78M8ATW5_TRIUA; Transcription factor MYB1R1
STRINGMLOC_20277.18e-39(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP78863348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.12e-29Homeodomain-like transcriptional regulator